1. ABC of Anarchism.

ABC des Anarchismus.

2. My ABC book!

Meine ABC-Fibel!

3. It's an ABC wound.

Das ist eine ABC Wunde.

4. Displays with Automatic Brightness Control (ABC)

Displays mit automatischer Helligkeitsregelung (ABC)

5. That big book is an ABC book.

Ein Schüler braucht eine ABC-Fibel.

6. A moment ago that said ABC News.

Aber gerade eben stand da noch " ABC News ".

7. Impulse!'s parent company, ABC-Paramount Records, was established in 1955 as the recording division of the American Broadcasting Company (ABC).

ABC Records startete im Jahre 1955 unter dem Namen ABC-Paramount Records, dem Schallplattenlabel der Am-Par Record Corporation (eine Tochterfirma von "American Broadcasting-Paramount Theaters, Inc"), gegründet in New York City im Jahre 1955.

8. ABC analysis is frequently combined with Pareto analysis.

Dabei wird sie oftmals mit der ABC-Analyse verbunden.

9. Point 23: Definition of "'Automated Border Control' (ABC)

Nummer 23: „automatisierte Grenzkontrolle“

10. One of the exporting producers, ABC Chemicals Co.

Für einen der ausführenden Hersteller, nämlich ABC Chemicals Co.

11. I got some ABC-type information for you, lady.

Ich werde Ihnen mal was sagen, Lady.

12. ABC analysis is used in SAP NetWeaver Business Intelligence.

Die ABC-Analyse wird in SAP NetWeaver Business Intelligence verwendet.

13. Indicator that is assigned by the procedure of ABC analysis.

Kennzeichen, das gemäß der ABC-Analyse für Objekte vergeben wird.

14. RABC is the On Mode percent power reduction due to ABC,

RABC ist die durch die automatische Helligkeitsregelung (ABC) bewirkte prozentuale Verringerung der Leistungsaufnahme im Ein-Zustand.

15. The fracture type is described by the AO comprehensive ABC classification.

Die Fraktur-Klassifikation erfolgt nach der ABC-Einteilung vonMaurice Müller.

16. At week # the proportion of subjects with HIV RNA < # copies/ml were # %, # % and # % for the ZDV/#TC/ABC, ZDV/#TC/EFV and ZDV/#TC/ABC/EFV arms, respectively

Nach # Wochen betrug die Quote der Patienten mit einer HIV-RNA von &lt; # Kopien/ml # %, # % und # % in den Armen mit ZDV/#TC/ABC, ZDV/#TC/EFV und ZDV/#TC/ABC/EFV

17. RST is the consecutive number of the substance in the series ABC

RST: die laufende Nummer des Stoffes in der ABC-Reihe

18. Due to the ABC analysis the GC for each speciality was specified.

Für diese idealtypische Annahme beträgt der GK 0,86.

19. - RST is the consecutive number of the substance in the series ABC,

- RST: die laufende Nummer des Stoffes in der ABC-Reihe,

20. Prior notification of a concentration (Case M.9324 — ALSO/ABC Data) ( 1 )

Vorherige Anmeldung eines Zusammenschlusses (Sache M.9324 — ALSO/ABC Data) ( 1 )

21. K-ABC-Number Recall is a valid instrument for children with APD.

Das K-ABC ZN wird den Anforderungen an seine konvergente Validität für Kinder mit AVWS gut gerecht.

22. In August 2012 Shinichi Mochizuki claimed a proof of the abc conjecture.

2012: Shinichi Mochizuki hat möglicherweise die abc-Vermutung bewiesen.

23. ABC then asked her to do a movie based on the book.

Daraufhin bat ihn die ABC-Filmproduktion, das Stück mit der Bühnen-Besetzung zu verfilmen.

24. RST is the consecutive number of the substance in the series ABC;

RST: laufende Nummer des Stoffes in der ABC-Reihe;

25. Measured on mode power at 100 lux ambient light at the ABC sensor

Gemessene Leistungsaufnahme im Ein-Zustand bei einem Umgebungslicht von 100 Lux am ABC-Sensor

26. TAGs with three different fatty acids (ABC, here OLLn, PLLn, PoOLn, PPoLn) (9)

TAG mit drei unterschiedlichen Fettsäuren (ABC, hier OLLn, PLLn, PoOLn, PPoLn) (9)

27. Meeting codes are in the form abc-nmop-xyz (the dashes are optional).

Besprechungscodes sind nach dem Muster abc-nmop-xyz formatiert (Bindestriche optional).

28. Measured on mode power at 12 lux ambient light at the ABC sensor

Gemessene Leistungsaufnahme im Ein-Zustand bei einem Umgebungslicht von 12 Lux am ABC-Sensor

29. The measured screen luminance at 60 lux ambient light at the ABC sensor

Gemessene Bildschirmluminanz des bei einem Umgebungslicht von 60 Lux am ABC-Sensor

30. As always, the scan is available for your enjoyment in the "Amiga In ABC.

Wie immer, der Scan für Ihren Genuss in der zur Verfügung "Amiga In ABC.

31. Create complex reports and ABC-analysis about your customers and products, simple and fast.

Erstellen Sie einfach komplexe Reports und ABC-Analysen über Ihre Kunden und Produkte.

32. Nevertheless, we have developed a small glossary for you: from ABC-Analysis to WinCATI.

Dennoch haben wir ein kleines Lexikon für Sie entwickelt: Von der ABC-Analyse zur Zufriedenheit.

33. All store purchases will show up on your credit card as ABC Dildos, incorporated.

Alle Ladeneinkäufe werden auf ihrer Kreditkarte als ABC Dildos GmbH angezeigt.

34. An American Broadcasting Company (ABC) affiliate, KXLY-TV is translated as K09DG in Omak.

Eine ABC-Tochter, KXLY-TV wird in Omak als K09DG ausgestrahlt.

35. This paper introduces a land suitability analysis, based on the Dutch “ABC location planning”.

In diesem Beitrag wird eine adaptierte Form der niederländischen ABC-Standortplanung als Methode der Baulandpotenzialanalyse diskutiert.

36. You perform an ABC analysis to classify objects according to specific criteria or performance measures.

Die ABC-Analyse dient zur Klassifizierung von Objekten nach bestimmten Kriterien oder Kennzahlen.

37. Those statistics also show that Chinese imports are now mainly entering the Union via ABC.

Die entsprechenden Statistiken zeigen auch, dass die Einfuhren aus der VR China mittlerweile hauptsächlich über ABC in die Union gelangen.

38. (Broadcast on ABC Radio National, 1999) AustLit Agent: Krausmann, Rudi in: The Australian Literature Resource.

(Hörspiel für das ABC Radio National, 1999) AustLit Agent: Krausmann, Rudi in: The Australian Literature Resource.

39. Also in 2011, Shaw appeared as Lisa in the ABC Family original film Teen Spirit.

Außerdem erschien Shaw 2011 als Lisa in dem ABC Family Original Movie Teen Spirit.

40. RST is the consecutive number of the substances referred to in the sub-sequence ABC ;

RST laufende Nummer der Verbindungen des unter ABC aufgeführten Elements ;

41. He began by assuming, that in triangle ABC, angle A and B are both obtuse.

Zuerst hat er angenommen, dass im Dreieck ABC die Winkel bei A und B beide stumpfwinkelig sind.

42. The Allometric Biomass and Carbon (ABC) factors database inventories carbon stock gathered from National Forest Inventories.

Die Datenbank zu allometrischen Biomasse- und Kohlenstofffaktoren inventarisiert den Kohlenstoffgehalt aus nationalen Forstbeständen.

43. Members of the ABCA subfamily comprise the only major ABC subfamily found exclusively in multicellular eukaryotes.

Die Mitglieder der ABCA Subfamilie bilden die einzige ABC Subfamilie, die ausschließlich in multizellulären Eukaryoten gebildet werden.

44. Purpose: Previous studies indicated that ATP-binding cassette (ABC) membrane transporters protect against UV-induced apoptosis.

Hintergrund: In früheren Studien konnte gezeigt werden, dass Mitglieder der Familie der ABC-(„ATP-binding cassette“-)Membrantransporter gegen UV-induzierte Apoptose schützen können.

45. The protection of human health and the environment primarily considered for the safe ABC product development.

Der Schutz der menschlichen Gesundheit und der Umwelt stehen im Mittelpunkt einer sicheren ABC Produktentwicklung.

46. “Saint Pancras Brought Good Luck to Madrid” was the headline in the Spanish weekly ABC, international edition.

„Der heilige Pankratius hat Madrid Glück gebracht“, lautete eine Überschrift in der internationalen Ausgabe der spanischen Wochenzeitung ABC.

47. The methodology developed is based on ABC analysis and is presented in detail in this academic work.

Die entwickelte Methodik ist an eine ABC-Analyse angelehnt und wird in dieser wissenschaftlichen Arbeit genauer dargestellt.

48. It was about this time that I received a call from the American Broadcasting Company, ABC television.

Ungefähr um diese Zeit bekam ich von der Fernsehgesellschaft American Broadcasting Company einen Anruf.

49. This leads to a substantial decrease in the computational efficiency of the above basic ABC rejection algorithm.

Dies führt zu einer wesentlichen Verringerung der Recheneffizienz des obigen grundlegenden ABC-Rejection-Algorithmus.

50. The following point shall be inserted after point #abc (Commission Decision #/#/EC) of Annex # to the Agreement

In Anhang # des Abkommens wird nach Nummer #abc (Entscheidung #/#/EG der Kommission) folgende Nummer eingefügt

51. On January 25, 2006, it was announced that Wallace would cover auto racing events for ESPN and ABC.

Am 25. Januar 2006 wurde verkündet, dass Wallace Autorennen für ESPN und ABC kommentieren werde.

52. In 1952, it acquired the Altorfer Bros. Company, which made home laundry equipment under the ABC brand name.

1952 kaufte man die Altdorfer Bros. Company auf, die Haushaltswaschmaschinen unter dem Markennamen ABC herstellte.

53. The race Chavornay has with 13,6% the lowest aggressivity number and the race ABC with 59,0% the highest.

Je größer die Aggressivitätszahl einer Rasse ist, desto seltener wird ein mit ihr resistent reagierender Wirt von einer anderen Rasse befallen.

54. His son, Brian Rooney, has been a correspondent for ABC since the 1980s and lives in Los Angeles.

Sein Sohn, Brian Rooney arbeitet seit den 1980er Jahren als Korrespondent für ABC.

55. When I came to ABC, you guys put in the contract that I can choose my own music.

Laut Vertrag kann ich meine Musik selbst aussuchen.

56. ABC Artists’ Books Cooperative is an international network created by and for artists who make print-on-demand books.

2009 gründete er ABC Artists' Books Cooperative, ein internationales Netzwerk von und für Künstler, die Print-on-demand-Künstlerbücher erstellen.

57. forward exchange rate between the euro and a foreign currency ABC on the repurchase date of the swap (M)

Terminkurs des Euro gegenüber einer Fremdwährung ABC am Rückkaufstag des Swapgeschäfts (M)

58. To use the language of numbers . . . John Paul II’s visit has broken all the country’s records.” —ABC, Madrid daily newspaper.

Viele sagten, ... der Besuch von Johannes Paul II. habe alle Rekorde des Landes gebrochen“ (ABC, Madrider Tageszeitung).

59. This new German media-ABC of India has taken over the older media mantra which read, Caste, Creed and Corruption.

Dieses neue deutsche Fernseh-ABC zu Indien hat das alte Medien-Mantra von Kaste, Konfession und Korruption ersetzt.

60. On 14 February 1967, the American Broadcasting Company (ABC) received the exclusive broadcasting rights for the US and Latin America.

Am 14. Februar 1967 erhielt die American Broadcasting Company die exklusiven Übertragungsrechte für die USA und Lateinamerika, am 15. Oktober 1967 erhielt NHK jene für Japan.

61. The association of osteosynthesis (AO) combined sections of the classification both fromLauge-Hansen andWeber, so that the ABC pattern ofM.

Die Arbeitsgemeinschaft für Osteosynthese (AO) hat Teile der Klassifikation sowohl vonLauge-Hansen, als auch vonDanis-Weber integriert, sodaß sich das ABC-Schema vonM.

62. In the early 1930s she had a number of articles published in two Spanish newspapers Blanco y Negro and ABC.

In den frühen 1930er Jahren veröffentlichte sie zunächst eine Anzahl Artikel in den spanischen Zeitungen Blanco y Negro und Diario ABC.

63. Acid Black Cherry (abbreviated as ABC) is the solo project of the former lead vocalist of Janne Da Arc, Yasu.

Acid Black Cherry (kurz A.B.C.) ist ein Soloprojekt des japanischen Sängers Yasu (Janne Da Arc).

64. In 1962 he became the first Black network news correspondent for ABC television network as a United Nations (UN) reporter.

1962 wurde er der erste afroamerikanische Nachrichten-Korrespondent des ABC-TV-Netzwerkes und arbeitete zunächst als UNO-Reporter.

65. Those armored personell carriers are called are Armored Binome Carriers (ABC, not to be confused with the American Broadcasting Company.

Es sind "Armored Binome Carriers" (ABC, nicht zu verwechseln mit der American Broadcasting Company.

66. School books (ABC, civilités puériles, psalters for school use) occupy an important place in the editorial economy of the Old Regime.

In der Verlagswirtschaft des Ancien Régime spielt das Elementarschulbuch (ABC, civilités puériles – Umgangsformen für Kinder -, Stundenbücher und Psalter für den Schulgebrauch) eine wichtige Rolle.

67. The Index number for each substance is in the form of a digit sequence of the type ABC-RST-VW-Y, where

Zur Numerierung der Stoffe wurde eine Zeichensequenz vom Typ ABC-RST-VW-Y gewählt, deren einzelne Zeichen folgende Bedeutung haben

68. The index number for each substance is in the form of a digit sequence of the type ABC-RST-VW-Y, where:

Zur Nummerierung der Stoffe wurde eine Zeichensequenz vom Typ ABC-RST-VW-Y gewählt, deren einzelne Zeichen folgende Bedeutung haben:

69. The Gini coefficient (GC, range: 0–1) is a measurement of the level of standardization when an economical ABC analysis is performed.

Beide Ziele sind über eine Standardisierung der Leistungserbringung zu erreichen.

70. The series was not included in the main program, since ABC does not currently broadcasting for another series of women-run freely make.

Die Serie wurde nicht in das Hauptprogramm aufgenommen, da ABC derzeit keine rechtlichen Rundfunks für eine weitere Reihe von Frauen geführte frei zu machen.

71. In a slideshow article by ABC News (America) in August, she was listed among 12 "ABC's Global Pop Sensations You've Never Heard Of".

ABC News nannte Mỹ Tâm in einem Artikel als eine von zwölf „Global Pop Sensations You've Never Heard Of“.

72. Note 2: The explanations for the abbreviations can be found in Procedures for Air Navigation Services — ICAO Abbreviations and Codes (PANS-ABC, Doc 8400).

Anmerkung 2: Die Abkürzungen sind erläutert im Handbuch Procedures for Air Navigation Services — ICAO Abbreviations and Codes (PANS-ABC, Doc 8400) (Verfahren für Flugsicherungsdienste — ICAO-Abkürzungen und -Codes).

73. It is essentially a (non-exclusive) alternative to abc2ps, being based on the abc2ps PostScript code together with the ABC parser from the abcmidi package.

Es ist grundsätzlich eine (nichtexklusive) Alternative zu abc2ps, die auf dem abc2ps-PostScript-Kode zusammen mit dem ABC-Parser aus dem abcmidi-Paket basiert.

74. Acute trauma with laryngeal fracture is a rare injury affecting all functions of the larynx. Resuscitation follows the ABC principles for acute trauma life support.

Die dislozierte Larynxfraktur ist ein seltenes Ereignis, das sämtliche Larynxfunktionen beeinträchtigen kann.

75. The ABC is ideal for U.S. companies who want marketing exposure at IWA and have not exhibited before, or, could not secure a booth at the upcoming show.

Um ihre Produkte auch auf dem deutschen bzw. europäischen Markt anbieten zu können, suchen zahlreiche der anwesenden US-Firmen nach Partnern und Vertretern.

76. ABC has rapidly gained popularity over the last years and in particular for the analysis of complex problems arising in biological sciences, e.g. in population genetics, ecology, epidemiology, and systems biology.

ABC hat in den letzten Jahren immens an Popularität gewonnen, insbesondere für die Analyse komplexer Probleme in der Populationsgenetik, Ökologie, Epidemiologie und Systembiologie.

77. After the Reformation, the ABC Book was rewritten in a Calvinist way, children must learn the Heidelberg Catechism and to advanced students of the elementary school so-called testament literature was submitted.

Das Abc-Buch wurde kalvinisiert, die Kinder lernten den Heidelberger Katechismus und Fortgeschrittenen wurde die sogenannte Testamentenliteratur angeboten.

78. Wahlworts with only three letters occasionally appeared in the code, such as ABC or XXX, but also very long compounds, such as Donaudampfschiffahrtsgesellschaftskapitän (Danube steamboating association captain) or Hottentottenpotentatentantenattentäter (Hottentot potentate aunt assassin ).

In der Praxis kamen auch gelegentlich Wahlwörter nur der Länge drei vor wie ABC oder XXX, aber auch sehr lange Wortungetüme wie DONAUDAMPFSQIFFAHRTSGESELLSQAFTSKAPITAEN oder HOTTENTOTENPOTENTATENTANTENATTENTAETER.

79. In order to have a harmonised approach Member States shall use for ABC lanes the signs contained in Annex III Part D shall be used by all MS at all border crossing points.

Zum Zwecke eines einheitlichen Vorgehens verwenden alle Mitgliedstaaten für Kontrollspuren mit automatisierten Grenzkontrollanlagen an allen Grenzübergangsstellen die Schilder in Anhang III Teil D.

80. Notably the Horta emerging/tunneling through the rock face when Captain Kirk encountered the Horta mother on his own was a combination of new and original footage. * The "suit" for the Horta, also with Prohaska inside, first appeared in the final episode of the original ABC series ''The Outer Limits''.

Diese eine [[Mutterhorta]] hat die Aufgabe für die [[Kind|Nachkommenschaft]], welche aus unzähligen [[Ei]]ern aus [[Silizium]] besteht, zu sorgen.