Use "abc" in a sentence
1. ABC-Schütze.
Abecedarian!
2. Meine ABC-Fibel!
My ABC book!
3. ABC des Anarchismus.
ABC of Anarchism.
4. ABC-Register zum Einhängen
Alphabetically indexed suspension files
5. Displays mit automatischer Helligkeitsregelung (ABC)
Displays with Automatic Brightness Control (ABC)
6. Das ist eine ABC Wunde.
It's an ABC wound.
7. Ein Schüler braucht eine ABC-Fibel.
That big book is an ABC book.
8. Aber gerade eben stand da noch " ABC News ".
A moment ago that said ABC News.
9. RST: laufende Nummer des Stoffes in der ABC-Reihe
RST is the consecutive number of the substance in the series ABC
10. ABC ist krank darüber, versteckte Kamera zu verlieren.
ABC's sick about losingCandid Camera.
11. - RST: die laufende Nummer des Stoffes in der ABC-Reihe,
- RST is the consecutive number of the substance in the series ABC,
12. Die Fraktur-Klassifikation erfolgt nach der ABC-Einteilung vonMaurice Müller.
The fracture type is described by the AO comprehensive ABC classification.
13. 2012: Shinichi Mochizuki hat möglicherweise die abc-Vermutung bewiesen.
In August 2012 Shinichi Mochizuki claimed a proof of the abc conjecture.
14. RST: laufende Nummer des Stoffes in der ABC-Reihe;
RST is the consecutive number of the substance in the series ABC;
15. Für einen der ausführenden Hersteller, nämlich ABC Chemicals Co.
One of the exporting producers, ABC Chemicals Co.
16. Dabei wird sie oftmals mit der ABC-Analyse verbunden.
ABC analysis is frequently combined with Pareto analysis.
17. RST laufende Nummer der Verbindungen des unter ABC aufgeführten Elements ;
RST is the consecutive number of the substances referred to in the sub-sequence ABC ;
18. RST: die laufende Nummer des Stoffes in der ABC-Reihe
RST is the consecutive number of the substance in the series ABC
19. Die ABC-Analyse wird in SAP NetWeaver Business Intelligence verwendet.
ABC analysis is used in SAP NetWeaver Business Intelligence.
20. Besprechungscodes sind nach dem Muster abc-nmop-xyz formatiert (Bindestriche optional).
Meeting codes are in the form abc-nmop-xyz (the dashes are optional).
21. Vorherige Anmeldung eines Zusammenschlusses (Sache M.9324 — ALSO/ABC Data) ( 1 )
Prior notification of a concentration (Case M.9324 — ALSO/ABC Data) ( 1 )
22. Kennzeichen, das gemäß der ABC-Analyse für Objekte vergeben wird.
Indicator that is assigned by the procedure of ABC analysis.
23. Eine ABC-Tochter, KXLY-TV wird in Omak als K09DG ausgestrahlt.
An American Broadcasting Company (ABC) affiliate, KXLY-TV is translated as K09DG in Omak.
24. Alle Ladeneinkäufe werden auf ihrer Kreditkarte als ABC Dildos GmbH angezeigt.
All store purchases will show up on your credit card as ABC Dildos, incorporated.
25. Nach # Wochen betrug die Quote der Patienten mit einer HIV-RNA von < # Kopien/ml # %, # % und # % in den Armen mit ZDV/#TC/ABC, ZDV/#TC/EFV und ZDV/#TC/ABC/EFV
At week # the proportion of subjects with HIV RNA < # copies/ml were # %, # % and # % for the ZDV/#TC/ABC, ZDV/#TC/EFV and ZDV/#TC/ABC/EFV arms, respectively
26. Terminkurs des Euro gegenüber einer Fremdwährung ABC am Rückkaufstag des Swapgeschäfts (M)
forward exchange rate between the euro and a foreign currency ABC on the repurchase date of the swap (M)
27. TAG mit drei unterschiedlichen Fettsäuren (ABC, hier OLLn, PLLn, PoOLn, PPoLn) (9)
TAGs with three different fatty acids (ABC, here OLLn, PLLn, PoOLn, PPoLn) (9)
28. Gemessene Bildschirmluminanz des bei einem Umgebungslicht von 60 Lux am ABC-Sensor
The measured screen luminance at 60 lux ambient light at the ABC sensor
29. Gemessene Leistungsaufnahme im Ein-Zustand bei einem Umgebungslicht von 12 Lux am ABC-Sensor
Measured on mode power at 12 lux ambient light at the ABC sensor
30. Erstellen Sie einfach komplexe Reports und ABC-Analysen über Ihre Kunden und Produkte.
Create complex reports and ABC-analysis about your customers and products, simple and fast.
31. Die ABC-Analyse dient zur Klassifizierung von Objekten nach bestimmten Kriterien oder Kennzahlen.
You perform an ABC analysis to classify objects according to specific criteria or performance measures.
32. ABC Records startete im Jahre 1955 unter dem Namen ABC-Paramount Records, dem Schallplattenlabel der Am-Par Record Corporation (eine Tochterfirma von "American Broadcasting-Paramount Theaters, Inc"), gegründet in New York City im Jahre 1955.
Impulse!'s parent company, ABC-Paramount Records, was established in 1955 as the recording division of the American Broadcasting Company (ABC).
33. Sein Sohn, Brian Rooney arbeitet seit den 1980er Jahren als Korrespondent für ABC.
His son, Brian Rooney, has been a correspondent for ABC since the 1980s and lives in Los Angeles.
34. Am 25. Januar 2006 wurde verkündet, dass Wallace Autorennen für ESPN und ABC kommentieren werde.
On January 25, 2006, it was announced that Wallace would cover auto racing events for ESPN and ABC.
35. 1952 kaufte man die Altdorfer Bros. Company auf, die Haushaltswaschmaschinen unter dem Markennamen ABC herstellte.
In 1952, it acquired the Altorfer Bros. Company, which made home laundry equipment under the ABC brand name.
36. Wie immer, der Scan für Ihren Genuss in der zur Verfügung "Amiga In ABC.
As always, the scan is available for your enjoyment in the "Amiga In ABC.
37. Es sind "Armored Binome Carriers" (ABC, nicht zu verwechseln mit der American Broadcasting Company.
Those armored personell carriers are called are Armored Binome Carriers (ABC, not to be confused with the American Broadcasting Company.
38. Daraufhin bat ihn die ABC-Filmproduktion, das Stück mit der Bühnen-Besetzung zu verfilmen.
ABC then asked her to do a movie based on the book.
39. Dies führt zu einer wesentlichen Verringerung der Recheneffizienz des obigen grundlegenden ABC-Rejection-Algorithmus.
This leads to a substantial decrease in the computational efficiency of the above basic ABC rejection algorithm.
40. Gemessene Leistungsaufnahme im Ein-Zustand bei einem Umgebungslicht von 100 Lux am ABC-Sensor
Measured on mode power at 100 lux ambient light at the ABC sensor
41. Außerdem erschien Shaw 2011 als Lisa in dem ABC Family Original Movie Teen Spirit.
Also in 2011, Shaw appeared as Lisa in the ABC Family original film Teen Spirit.
42. Dennoch haben wir ein kleines Lexikon für Sie entwickelt: Von der ABC-Analyse zur Zufriedenheit.
Nevertheless, we have developed a small glossary for you: from ABC-Analysis to WinCATI.
43. In Anhang # des Abkommens wird nach Nummer #abc (Entscheidung #/#/EG der Kommission) folgende Nummer eingefügt
The following point shall be inserted after point #abc (Commission Decision #/#/EC) of Annex # to the Agreement
44. Der Schutz der menschlichen Gesundheit und der Umwelt stehen im Mittelpunkt einer sicheren ABC Produktentwicklung.
The protection of human health and the environment primarily considered for the safe ABC product development.
45. Die Mitglieder der ABCA Subfamilie bilden die einzige ABC Subfamilie, die ausschließlich in multizellulären Eukaryoten gebildet werden.
Members of the ABCA subfamily comprise the only major ABC subfamily found exclusively in multicellular eukaryotes.
46. Das K-ABC ZN wird den Anforderungen an seine konvergente Validität für Kinder mit AVWS gut gerecht.
K-ABC-Number Recall is a valid instrument for children with APD.
47. In diesem Beitrag wird eine adaptierte Form der niederländischen ABC-Standortplanung als Methode der Baulandpotenzialanalyse diskutiert.
This paper introduces a land suitability analysis, based on the Dutch “ABC location planning”.
48. Dieses neue deutsche Fernseh-ABC zu Indien hat das alte Medien-Mantra von Kaste, Konfession und Korruption ersetzt.
This new German media-ABC of India has taken over the older media mantra which read, Caste, Creed and Corruption.
49. (Hörspiel für das ABC Radio National, 1999) AustLit Agent: Krausmann, Rudi in: The Australian Literature Resource.
(Broadcast on ABC Radio National, 1999) AustLit Agent: Krausmann, Rudi in: The Australian Literature Resource.
50. RABC ist die durch die automatische Helligkeitsregelung (ABC) bewirkte prozentuale Verringerung der Leistungsaufnahme im Ein-Zustand.
RABC is the On Mode percent power reduction due to ABC,
51. Das Abc-Buch wurde kalvinisiert, die Kinder lernten den Heidelberger Katechismus und Fortgeschrittenen wurde die sogenannte Testamentenliteratur angeboten.
After the Reformation, the ABC Book was rewritten in a Calvinist way, children must learn the Heidelberg Catechism and to advanced students of the elementary school so-called testament literature was submitted.
52. 1962 wurde er der erste afroamerikanische Nachrichten-Korrespondent des ABC-TV-Netzwerkes und arbeitete zunächst als UNO-Reporter.
In 1962 he became the first Black network news correspondent for ABC television network as a United Nations (UN) reporter.
53. Viele sagten, ... der Besuch von Johannes Paul II. habe alle Rekorde des Landes gebrochen“ (ABC, Madrider Tageszeitung).
To use the language of numbers . . . John Paul II’s visit has broken all the country’s records.” —ABC, Madrid daily newspaper.
54. Die entwickelte Methodik ist an eine ABC-Analyse angelehnt und wird in dieser wissenschaftlichen Arbeit genauer dargestellt.
The methodology developed is based on ABC analysis and is presented in detail in this academic work.
55. Zuerst hat er angenommen, dass im Dreieck ABC die Winkel bei A und B beide stumpfwinkelig sind.
He began by assuming, that in triangle ABC, angle A and B are both obtuse.
56. Zur Numerierung der Stoffe wurde eine Zeichensequenz vom Typ ABC-RST-VW-Y gewählt, deren einzelne Zeichen folgende Bedeutung haben
The Index number for each substance is in the form of a digit sequence of the type ABC-RST-VW-Y, where
57. „Der heilige Pankratius hat Madrid Glück gebracht“, lautete eine Überschrift in der internationalen Ausgabe der spanischen Wochenzeitung ABC.
“Saint Pancras Brought Good Luck to Madrid” was the headline in the Spanish weekly ABC, international edition.
58. Ich gab ihm das Buch: Die Frau hat immer Recht. Aus ihm lernte Jefferson das ABC jeder guten Ehe:
In the book that I got him, The Woman Is Always Right Jefferson has learned the ABC's of any good marriage are-
59. ABC News nannte Mỹ Tâm in einem Artikel als eine von zwölf „Global Pop Sensations You've Never Heard Of“.
In a slideshow article by ABC News (America) in August, she was listed among 12 "ABC's Global Pop Sensations You've Never Heard Of".
60. 2009 gründete er ABC Artists' Books Cooperative, ein internationales Netzwerk von und für Künstler, die Print-on-demand-Künstlerbücher erstellen.
ABC Artists’ Books Cooperative is an international network created by and for artists who make print-on-demand books.
61. Zur Nummerierung der Stoffe wurde eine Zeichensequenz vom Typ ABC-RST-VW-Y gewählt, deren einzelne Zeichen folgende Bedeutung haben:
The index number for each substance is in the form of a digit sequence of the type ABC-RST-VW-Y, where:
62. Die entsprechenden Statistiken zeigen auch, dass die Einfuhren aus der VR China mittlerweile hauptsächlich über ABC in die Union gelangen.
Those statistics also show that Chinese imports are now mainly entering the Union via ABC.
63. In den frühen 1930er Jahren veröffentlichte sie zunächst eine Anzahl Artikel in den spanischen Zeitungen Blanco y Negro und Diario ABC.
In the early 1930s she had a number of articles published in two Spanish newspapers Blanco y Negro and ABC.
64. Hintergrund: In früheren Studien konnte gezeigt werden, dass Mitglieder der Familie der ABC-(„ATP-binding cassette“-)Membrantransporter gegen UV-induzierte Apoptose schützen können.
Purpose: Previous studies indicated that ATP-binding cassette (ABC) membrane transporters protect against UV-induced apoptosis.
65. Die Arbeitsgemeinschaft für Osteosynthese (AO) hat Teile der Klassifikation sowohl vonLauge-Hansen, als auch vonDanis-Weber integriert, sodaß sich das ABC-Schema vonM.
The association of osteosynthesis (AO) combined sections of the classification both fromLauge-Hansen andWeber, so that the ABC pattern ofM.
66. ABC hat in den letzten Jahren immens an Popularität gewonnen, insbesondere für die Analyse komplexer Probleme in der Populationsgenetik, Ökologie, Epidemiologie und Systembiologie.
ABC has rapidly gained popularity over the last years and in particular for the analysis of complex problems arising in biological sciences, e.g. in population genetics, ecology, epidemiology, and systems biology.
67. In der Verlagswirtschaft des Ancien Régime spielt das Elementarschulbuch (ABC, civilités puériles – Umgangsformen für Kinder -, Stundenbücher und Psalter für den Schulgebrauch) eine wichtige Rolle.
School books (ABC, civilités puériles, psalters for school use) occupy an important place in the editorial economy of the Old Regime.
68. Es ist grundsätzlich eine (nichtexklusive) Alternative zu abc2ps, die auf dem abc2ps-PostScript-Kode zusammen mit dem ABC-Parser aus dem abcmidi-Paket basiert.
It is essentially a (non-exclusive) alternative to abc2ps, being based on the abc2ps PostScript code together with the ABC parser from the abcmidi package.
69. Die Serie wurde nicht in das Hauptprogramm aufgenommen, da ABC derzeit keine rechtlichen Rundfunks für eine weitere Reihe von Frauen geführte frei zu machen.
The series was not included in the main program, since ABC does not currently broadcasting for another series of women-run freely make.
70. In der Praxis kamen auch gelegentlich Wahlwörter nur der Länge drei vor wie ABC oder XXX, aber auch sehr lange Wortungetüme wie DONAUDAMPFSQIFFAHRTSGESELLSQAFTSKAPITAEN oder HOTTENTOTENPOTENTATENTANTENATTENTAETER.
Wahlworts with only three letters occasionally appeared in the code, such as ABC or XXX, but also very long compounds, such as Donaudampfschiffahrtsgesellschaftskapitän (Danube steamboating association captain) or Hottentottenpotentatentantenattentäter (Hottentot potentate aunt assassin ).
71. Anmerkung 2: Die Abkürzungen sind erläutert im Handbuch „Procedures for Air Navigation Services — ICAO Abbreviations and Codes (PANS-ABC, Doc 8400)“ (Verfahren für Flugsicherungsdienste — ICAO-Abkürzungen und -Codes).
Note 2: The explanations for the abbreviations can be found in Procedures for Air Navigation Services — ICAO Abbreviations and Codes (PANS-ABC, Doc 8400).
72. Anmerkung 2: Die Abkürzungen sind erläutert im Handbuch Procedures for Air Navigation Services — ICAO Abbreviations and Codes (PANS-ABC, Doc 8400) (Verfahren für Flugsicherungsdienste — ICAO-Abkürzungen und -Codes).
Note 2: The explanations for the abbreviations can be found in Procedures for Air Navigation Services — ICAO Abbreviations and Codes (PANS-ABC, Doc 8400).
73. Es gab Berichte über den Film in einigen öffentlich-rechtlichen Fernsehsendern, z. B. bei Televisión Española im Nachrichtenprogramm laSexta, bei Cuatro und bei La 2, sowie in verschiedenen Zeitungen, Magazinen und Radiosendern, darunter El País, El Mundo, ABC, Público, AND, La Gaceta, Fotogramas, Cadena Ser und los 40 Principales.
There have been reports about the film in various of the non-"pay per view" television channels of the country: TVE, in the news program of LaSexta, CNN+ and Cuatro, and in a divulgative program of La 2. ; as well as in different newspapers, magazines and radios: El País, El Mundo, ABC, Público, AND, La Gaceta, Fotogramas, Cadena Ser, los 40 Principales.